PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400020633
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 382aa    MW: 42798 Da    PI: 9.1515
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400020633genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.33.2e-3354111260
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                           +DgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkver+  d++++ei+Y+g+Hnh+k
  PGSC0003DMP400020633  54 EDGYNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERNL-DGHITEIVYKGSHNHPK 111
                           8****************************************.***************85 PP

2WRKY106.71.1e-33215273159
                           ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           ldDgy+WrKYGqK+vkg+++prsYY+Ct++gCpv+k+ver+++d ++v++tYeg+Hnh+
  PGSC0003DMP400020633 215 LDDGYRWRKYGQKVVKGNPNPRSYYKCTFTGCPVRKHVERASHDLRAVITTYEGKHNHD 273
                           59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.38848112IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-2748112IPR003657WRKY domain
SuperFamilySSF1182906.41E-2549112IPR003657WRKY domain
SMARTSM007743.1E-3553111IPR003657WRKY domain
PfamPF031065.2E-2554110IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-37200275IPR003657WRKY domain
SuperFamilySSF1182901.44E-29207275IPR003657WRKY domain
PROSITE profilePS5081138.067210275IPR003657WRKY domain
SMARTSM007744.3E-39215274IPR003657WRKY domain
PfamPF031065.1E-26216273IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MTRQQQTTEF STAKTGVKSE VAPIQSFSQE NMPNNPAPVH YCQPSQYVRE QKAEDGYNWR  60
KYGQKQVKGS ENPRSYYKCT FPNCPTKKKV ERNLDGHITE IVYKGSHNHP KPQSTRRSSS  120
QSVQNLAYSN LDVTNQPNAF HENGQRDSFA VTDNSSASFG DEDVDQGSPI SKSGENEPEA  180
KRWKGDNENE VISSASRTVR EPRIVVQTTS DIDILDDGYR WRKYGQKVVK GNPNPRSYYK  240
CTFTGCPVRK HVERASHDLR AVITTYEGKH NHDVPAARGS GSYAMNRPPT GSNNNMPVVP  300
RPTVLANHSN QGMNFNDTFF NTTQIQPPIT LQMLQSSGSS SYSGFGNSSG SYMNQMQHTN  360
NSKPISKEEP KDDLFFNSFL N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-3754276878Probable WRKY transcription factor 4
2lex_A4e-3754276878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3663890.0AY366389.1 Solanum chacoense WRKY-type transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360818.10.0PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-123WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLM1AU580.0M1AU58_SOLTU; Uncharacterized protein
STRINGSolyc09g014990.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-122WRKY DNA-binding protein 33
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]